Программа учебной дисциплины введение в науки о жизни по направлению 080100. 62 «Экономика» подготовки бакалавра



Дата19.06.2016
өлшемі117.68 Kb.
түріПрограмма

НОУ ВПО «РОССИЙСКАЯ ЭКОНОМИЧЕСКАЯ ШКОЛА» (институт)
программа учебной дисциплины

ВВЕДЕНИЕ В НАУКИ О ЖИЗНИ

по направлению 080100.62 «Экономика» подготовки бакалавра

автор программы: А.В. Марков, д.б.н., markov_a@inbox.ru



Утверждена Cоветом Программы «___»_____________2012 г.

Исполнительный директор:

Е.В. Максимова___________________




Москва

2012




Цели освоения и краткое описание дисциплины


Основная цель освоения дисциплины – добиться понимания ключевых механизмов функционирования и развития биологических объектов. Дисциплина рассчитана на студентов, которые не собираются становиться профессиональными биологами, но тем не менее решили, что базовая биологическая грамотность будет им полезна. Действительно, в современном мире ясное понимание биологических закономерностей становится все важнее для построения адекватных моделей окружающего мира и самих себя, для способности компетентно судить об актуальных проблемах, в том числе этических, социальных и политических. Задача дисциплины не в том, чтобы загрузить память учащихся множеством биологических фактов, а в объяснении логики и структуры причинно-следственных связей, лежащих в основе функционирования живой природы. Понимание этой логики в рамках дисциплины достигается не путем абстрактных рассуждений, а путем рассмотрения конкретных экспериментальных данных и наглядных математических моделей. Ключевые идеи будут иллюстрироваться примерами из новейших исследований, логика и действенность рассматриваемых теорий будут демонстрироваться при помощи компьютерных моделей. Основное внимание уделено эволюции как неотъемлемому свойству жизни и главной объединяющей идее, придающей осмысленность всему массиву накопленных фактов. Предполагается, что студенты в результате изучения дисциплины смогут оперировать базовыми правилами функционирования и развития биологических систем и формулировать аргументированные суждения по широкому кругу теоретических и практических вопросов, например, таких: «действует ли на современных людей естественный отбор?», «грозит ли человечеству генетическое вырождение?», «оправданы ли попытки ограничить использование ГМО?», «почему почти у всех животных рождается поровну мальчиков и девочек?», «зачем нужно половое размножение и к каким последствиям ведет его утрата?», «как происходит самопроизвольное усложнение живых систем и противоречит ли это второму началу термодинамики и другим законам природы?», «почему бабочки похожи на цветы и почему те и другие кажутся нам красивыми?» и т.д. Кроме того, они должны понимать границы своей компетентности и способы их расширения.

Компетенции обучающегося, формируемые в результате освоения дисциплины


ОК-12, ОК-13, ПК-1, ПК-2, ПК-3, ПК-4, ПК-5, ПК-6, ПК-10, ПК-12, ПК-14, ПК-15

Структура и организация учебной дисциплины





Название раздела

Всего часов

Аудиторные часы

Самостоятельная работа

Лекции

Семинары

1

Молекулярные основы жизни

54

8

8

38

2

Эволюция

54

8

8

38

3

История Земли и жизни на ней

54

8

8

38

4

Экология, биотехнологии, биополитика

54

8

8

38




ИТОГО

216

32

32

152



Система оценивания и требования к выставлению итоговой оценки


Формы контроля знаний

Тип контроля

Форма контроля

Параметры

Вес в финальной оценке (%)

Текущий контроль



Контрольная работа

Письменная работа

35

Самостоятельная работа

Выполнение домашних заданий

20

Работа на семинарах

Активность в дискуссиях

10

Итоговый контроль

Экзамен

Письменная работа

35



Содержание дисциплины

1. МОЛЕКУЛЯРНЫЕ ОСНОВЫ ЖИЗНИ

ДНК, РНК, белки. Природа наследственности. Принцип комплементарности и репликация ДНК. Гены. Мутации. Соотношение генотипа и фенотипа. Транскрипция. Генетический код. Трансляция. Прокариотическая клетка. Мембраны. Минимальный геном. Эукариотическая клетка. Компартментализация. Органеллы. Клеточный цикл. Митоз. Метаболизм. Энергетика клетки. Обмен углеводов, липидов. Мембранный транспорт. Геном как интерактивная программа поведения клетки. Рецепторы и передача сигналов. Регуляторные системы. Регуляция экспрессии генов. Транскрипционные факторы. Промоторы, энхансеры. Пост-транскрипционная регуляция. Регуляторные РНК, РНК-интерференция. Генно-регуляторные сети. Природа изменчивости. Мутационная и модификационная изменчивость. Рекомбинация. Горизонтальный перенос. Трансдукция, трансформация, конъюгация. «Эгоистические» элементы. Вирусы, плазмиды, транспозоны, ретротранспозоны. Половое размножение. Мейоз и кроссинговер. Гаметы. Оплодотворение. Основы классической (менделевской) генетики.

2. ЭВОЛЮЦИЯ

Неизбежность эволюции (эволюция как способ существования жизни). Теория Дарвина. Естественный отбор. Отличия дарвинизма от других эволюционных концепций. Доказательства эволюции. Доказательства эволюции: методологические основы. Что такое «доказательство» в биологии. Наука и лженаука. Фальсифицируемость и проверяемые следствия.


Искусственный отбор. Изменения при доместикации. Переходные формы отбора (от искусственного к естественному). Биологическая систематика и эволюционное дерево. Сравнительно-анатомические доказательства эволюции. Гомологичные и аналогичные органы. Атавизмы и рудименты. Наблюдаемая эволюция. Случаи быстрого видообразования в природе. Эволюционные эксперименты. Биогеографические доказательства эволюции. Островная биогеография. Основы эмбриологии. Базовые принципы онтогенеза. Эмбриологические доказательства эволюции. Evo-devo: современная эволюционная биология развития. Генно-регуляторные каскады, формирующие «генетическую программу развития». Биохимические и молекулярно-генетические доказательства эволюции. Методы сравнительного анализа нуклеотидных и аминокислотных последовательностей. Псевдогены, эндогенные ретровирусы. Палеонтологические доказательства эволюции. Геологическая летопись. Методы геохронологии, относительное и абсолютное датирование осадочных и магматических горных пород. Основы биостратиграфии. Филогенетические ряды. Переходные формы. Соотношение микро- и макроэволюции. Несовершенство организмов и его причины. В чьих «интересах» работает эволюция? Групповой селекционизм, организмоцентрический и геноцентрический подходы. Концепция эгоистичного гена. Механизмы и факторы эволюции. Основы генетической теории эволюции. Популяции и виды. Популяционная генетика. Нейтральные мутации. Дрейф генов. Методы построения эволюционных деревьев. Принцип «молекулярных часов». Естественный отбор: его основные формы; факторы, влияющие на направленность и эффективность отбора. Аллельное замещение. Эффект Болдуина, генетическая ассимиляция адаптивных модификаций, влияние поведения и обучаемости на направленность отбора. Направленность эволюции. Параллелизмы и их причины. Канализированность и «креоды» Уоддингтона.

Коэволюция. Эволюционные «гонки вооружений». Манипуляции. Экстрасоматические адаптации. Расширенный фенотип. «Генетический детерминизм» и «генетический редукционизм». Плейотропность и мультигенность. Вероятностный характер причинно-следственных связей между генами и фенотипическими признаками.

Храповик Мюллера. Адаптивный смысл полового размножения. Половые хромосомы. Почему в Y-хромосоме мало генов. Утрата полового размножения и ее эволюционные последствия. Половой отбор. Стратегии, алгоритмы и механизмы выбора полового партнера. Фишеровское «убегание». Индикаторы приспособленности. Принцип гандикапа. Половой отбор как «усилитель» обычного естественного отбора; его роль в видообразовании.

Балансирующий отбор. Почему соотношение полов почти всегда 1:1. Теоретико-игровой подход. Эволюционно стабильные стратегии. Родственный отбор. Правило Гамильтона. Эволюция кооперации и альтруизма: от бактерий до млекопитающих. Проблема социального паразитизма («обманщики») и возможности ее преодоления. Реципрокный альтруизм. Непрямая реципрокность.

Дивергенция. Репродуктивная изоляция. Механизмы видообразования. Симпатрия и аллопатрия. Правило Добжанского-Мёллера. Экологическое видообразование. Механизм «усиления» (reinforcement). Положительные обратные связи (создание ниш, цепные реакции видообразования). Экспериментальное изучение механизмов видообразования.Механизмы появления эволюционных новшеств. Сравнительная геномика. Дупликация и дивергенция генов. Эволюция кодирующих последовательностей и смена функций белков. Модификации регуляторных последовательностей и генно-регуляторных сетей

как основа эволюции животных. Блочно-комбинаторный принцип формирования эволюционных новшеств. Симбиоз и симбиогенез. Происхождение эукариот. Симбиотические сверхорганизмы. Метагеномный анализ. Биохимическая кооперация в симбиотических системах. «Молекулярное одомашнивание» вирусов и мобильных генетических элементов. Неслучайные мутации и наследование приобретенных признаков. «Молекулярный ламаркизм». Эпигенетика. Родительский импринтинг и конфликт полов.


3. ИСТОРИЯ ЗЕМЛИ И ЖИЗНИ НА НЕЙ

Происхождение жизни. Абиогенный синтез органики. Биогеохимические циклы. Автокатализ. Химическая эволюция. Мир РНК. Рибозимы. Функции РНК в клетке. Рудименты РНК-мира. Происхождение рибосом и генетического кода. Архей и протерозой. Строматолиты и микробные сообщества. Бактериальная палеонтология. Эволюция прокариот. Фотосинтез и кислородная революция. Эукариотизация биосферы. Великие протерозойские оледенения. Появление многоклеточных. Развитие жизни в палеозое. Кембрийский взрыв. Причины адаптивных радиаций. Ранняя дивергенция животного царства и HOX-гены. Выход растений, членистоногих и позвоночных на сушу. Становление лесных экосистем. Массовые вымирания, «фоновое» вымирание и их причины. Избирательность вымираний и «межвидовой отбор». Экологические кризисы и эволюция сообществ. Палеогеография. Дрейф континентов и тектоника плит. Климатические циклы. Развитие морской и наземной биоты в мезозое и кайнозое. Происхождение млекопитающих и птиц. Сопряженная эволюция динозавров и млекопитающих, растений и насекомых-опылителей. Количественные закономерности макроэволюции. Историческая динамика биоразнообразия.


4. ЭКОЛОГИЯ, БИОТЕХНОЛОГИИ, БИОПОЛИТИКА.

Основы популяционной экологии. Динамика популяций. Модель Лотки-Вольтерра. Экосистемы и трофические цепи. Круговороты углерода и азота. Роль микроорганизмов.Антропогенное воздействие на биосферу. Соотношение разнообразия и устойчивости сообществ. Рост населения земли, демографические модели и продовольственная проблема. Методы выведения новых пород и сортов. Селекция и генная инженерия. ГМО: мнимые и реальные риски. Проблема сохранения биоразнообразия. Клонирование. Генная терапия. Биоинформатика. Индивидуальная геномика. Стволовые клетки. Экстракорпоральное оплодотворение. Продление жизни. Эволюционная теория старения. Создание биомолекул с требуемыми свойствами мтодом искусственной эволюции. Искусственная жизнь. Синтетический геном. Создание искусственных микроорганизмов.




Методы обучения


Занятия проходят в форме интерактивных лекций. Во время занятий студентам

будут предлагаться вопросы "на понимание", среди которых будут преобладать

сравнительно простые (ответ дается прямо на занятии). Вопросы посложнее, требующие более глубокого осмысления полученных на занятии сведений, будут даваться в качестве письменных домашних заданий.
Базовые материалы для подготовки к занятиям и контрольным будут предоставляться на лекциях. Учебников на русском языке, полностью соответствующих программе и задачам курса и при этом достаточно современных, не существует, поэтому рекомендуемая литература должна рассматриваться как необходимое дополнение, но не замена лекциям.


Примеры заданий и вопросов для самостоятельной работы и промежуточного контроля


Примерные задания для текущего контроля, проводимого в форме письменных работ:

1.Идентифицировать белок по фрагменту аминокислотной последовательности.

Дан фрагмент аминокислотной последовательности некого белка:

fhfilpfiiaalaalhllflhetgsnnplgitshsdkitfhpyytikdalglllfilslm

Буквами обозначены аминокислоты в соответствии с общепринятой номенклатурой (которую учить не надо). Ваша первая задача – определить, что это за белок и чей он. Для этого воспользуйтесь программой BLAST, которая доступна по адресу:



http://blast.ncbi.nlm.nih.gov/Blast.cgi

Там нужно выбрать опцию protein blast (потому что вы работаете с белком – protein). На странице, которая откроется после этого, нужно ввести приведенную последовательность в большое окошко и нажать кнопку BLAST. Дождитесь результата (это может занять несколько минут, т.к. тысячи биологов ежесекундно пользуются этим сервисом). Разберитесь в результатах бласта и поймите, от какого белка этот фрагмент и какому организму принадлежит этот белок. Подсказка: совпадение должно быть полным, идентичных аминокислот - 100% (ведь мы ищем белок, который есть в базе).

Выяснив название белка и латинское название организма, которому этот белок принадлежит, найдите ПОЛНУЮ аминокислотную последовательность этого белка в базе данных Protein на сайте http://www.ncbi.nlm.nih.gov/protein/ (используя эти названия в качестве ключевых слов для поиска). Подсказка: полная последовательность должна содержать 380 аминокислот (380 aa protein). Скопируйте эту последовательность (там есть разные форматы, лучше всего использовать FASTA – это просто последовательность в текстовом формате) и при помощи программы BLAST найдите наиболее похожие (гомологичные) белки у свиньи (Sus scrofa), шимпанзе (Pan troglodytes) и мыши (Mus musculus). Для этого на странице белкового бласта (protein blast) нужно указать в специальном окне (Organism) названия этих трех организмов. Можно ввести все три вида сразу (там есть кнопка «добавить»).

Дубликаты в результатах бласта игнорируйте. Проанализируйте результаты и определите, с белком какого из трех видов наиболее сходен исходный белок.



Список основной и дополнительной литературы

Основная литература

Дарвин Ч. Происхождение видов путем естественного отбора. (Любое издание.)

Еськов К.Ю. Удивительная палеонтология. История Земли и жизни на ней. М., 2007.

Марков А.В. Рождение сложности. Эволюционная биология сегодня: неожиданные открытия и новые вопросы. М., 2010.

Тейлор Д., Грин Н., Стаут У. Биология (в трех томах). 3-е издание. М., 2008.

1.1

Дополнительная литература


Албертс Б., Брей Д., Льюис Дж., Рэфф М., Робертс К., Уотсон Дж. Молекулярная биологии клетки (в трех томах). М., 1994.

Докинз Р. Эгоистичный ген. М., 1994.



Докинз Р. Расширенный фенотип. М., 2010.

Северцов А.С. Теория эволюции. М., 2005.


Достарыңызбен бөлісу:




©dereksiz.org 2020
әкімшілігінің қараңыз

    Басты бет